Structure of PDB 6xy6 Chain A Binding Site BS01

Receptor Information
>6xy6 Chain A (length=135) Species: 654928 (Sheeppox virus (strain TU-V02127)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEIC
NFILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKD
ENNEVVDDDLALNELINKFSSYQKDIISFVEKNKK
Ligand information
>6xy6 Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DASTKKLSECLKRIGDELDSNME
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xy6 Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax.
Resolution2.91415 Å
Binding residue
(original residue number in PDB)		I42 Y46 E49 F50 F56 I74 T78 S86 N137
Binding residue
(residue number reindexed from 1)		I38 Y42 E45 F46 F52 I70 T74 S82 N133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6xy6, PDBe:6xy6, PDBj:6xy6
PDBsum6xy6
PubMed32390192
UniProtA0A3F2YKH3

[Back to BioLiP]