Structure of PDB 6xy4 Chain A Binding Site BS01

Receptor Information
>6xy4 Chain A (length=127) Species: 654928 (Sheeppox virus (strain TU-V02127)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEIC
NFILQNNKSCYDINDVKNIIIETINSRPSVILASISLLSIIIKKKKDENN
DDDLALNELINKFSSYQKDIISFVEKN
Ligand information
>6xy4 Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSAAQLTAARLKALGDELHQRTMW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xy4 Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax.
Resolution2.04623 Å
Binding residue
(original residue number in PDB)		Y46 E49 F50 I53 F56 I74 T78 S86 F133
Binding residue
(residue number reindexed from 1)		Y42 E45 F46 I49 F52 I69 T73 S79 F123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6xy4, PDBe:6xy4, PDBj:6xy4
PDBsum6xy4
PubMed32390192
UniProtA0A3F2YKH3

[Back to BioLiP]