Structure of PDB 6xwv Chain A Binding Site BS01

Receptor Information
>6xwv Chain A (length=133) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEQEEASTKLMQWLRGVGDAPPSAENASVSSANELIFYQVDGIDYAFYNT
KEKAMLGYMRFKPYQKRSMKQAKVHPLKLLVQFGEFNVETLAVGEEKEVH
SVLRVGDMIEIDRGTRYSIQNAIDKVSVLMCIR
Ligand information
>6xwv Chain E (length=24) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TLTEQGLGKIIGERWARKYLKYHI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xwv Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
Resolution2.27 Å
Binding residue
(original residue number in PDB)		A1304 E1311 Y1315 Q1316 N1326 T1327 K1328 K1330
Binding residue
(residue number reindexed from 1)		A27 E34 Y38 Q39 N49 T50 K51 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007059 chromosome segregation
GO:0007080 mitotic metaphase chromosome alignment
GO:0016321 female meiosis chromosome segregation
GO:0034501 protein localization to kinetochore
GO:0051382 kinetochore assembly
GO:0071459 protein localization to chromosome, centromeric region
GO:0090230 regulation of centromere complex assembly
GO:2000736 regulation of stem cell differentiation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000779 condensed chromosome, centromeric region

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xwv, PDBe:6xwv, PDBj:6xwv
PDBsum6xwv
PubMed32134144
UniProtQ9VHP9

[Back to BioLiP]