Structure of PDB 6xtq Chain A Binding Site BS01

Receptor Information

>6xtq Chain A (length=302) Species: 471852 (Thermomonospora curvata DSM 43183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPSFDFDIPRRSPQEIAKGMVAIPGGTFRMGGEDPDAFPEDGEGPVRTVR
LSPFLIDRYAVSNRQFAAFVKATGYVTDAERYGWSFVFHAHVAPGTPVMD
AVVPEAPWWVAVPGAYWKAPEGPGSSITDRPNHPVVHVSWNDAVAYATWA
GKRLPTEAEWEMAARGGLDQARYPWGNELTPRGRHRCNIWQGTFPVHDTG
EDGYTGTAPVNAFAPNGYGLYNVAGNVWEWCADWWSADWHATESPATRID
PRGPETGTARVTKGGSFLCHESYCNRYRVAARTCNTPDSSAAHTGFRCAA
DP

Ligand information

>6xtq Chain C (length=14) Species: 471852 (Thermomonospora curvata DSM 43183) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ATTPLCGPSRASIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xtq Non-Coordinative Binding of O2 at the Active Center of a Copper-Dependent Enzyme
Resolution	1.4 Å
Binding residue (original residue number in PDB)	F38 E40 Y82 W84 F86 A101 V103 E105 W109 W228 Y273 C274 R276 N285 D288 S289 H293
Binding residue (residue number reindexed from 1)	F38 E40 Y82 W84 F86 A101 V103 E105 W109 W228 Y273 C274 R276 N285 D288 S289 H293

Enzymatic activity

Enzyme Commision number

1.8.3.7: formylglycine-generating enzyme.

Gene Ontology

	Molecular Function
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding
GO:0120147	formylglycine-generating oxidase activity
GO:1903136	cuprous ion binding

	Biological Process
GO:0018158	protein oxidation
GO:0043687	post-translational protein modification

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6xtq, PDBe:6xtq, PDBj:6xtq
PDBsum	6xtq
PubMed
UniProt	D1A7C3\|FGE_THECD Formylglycine-generating enzyme (Gene Name=Tcur_4811)

[Back to BioLiP]