Structure of PDB 6xro Chain A Binding Site BS01

Receptor Information
>6xro Chain A (length=182) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFT
HALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQ
KFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG
WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xro Designed Parasite-Selective Rhomboid Inhibitors Block Invasion and Clear Blood-Stage Malaria.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F146 W196 F197 G198 M247 S248 M249 A250
Binding residue
(residue number reindexed from 1)		F56 W106 F107 G108 M157 S158 M159 A160
Enzymatic activity
Enzyme Commision number 3.4.21.105: rhomboid protease.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xro, PDBe:6xro, PDBj:6xro
PDBsum6xro
PubMed32888502
UniProtP09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]