Structure of PDB 6xqa Chain A Binding Site BS01

Receptor Information
>6xqa Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xqa CD8 + T cell landscape in Indigenous and non-Indigenous people restricted by influenza mortality-associated HLA-A*24:02 allomorph.
Resolution2.16 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 H70 T73 E76 N77 I80 Y84 M97 F99 H114 T143 K146 W147 V152 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 H70 T73 E76 N77 I80 Y84 M97 F99 H114 T143 K146 W147 V152 Q156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links