Structure of PDB 6xp6 Chain A Binding Site BS01

Receptor Information

>6xp6 Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLR
QFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTLLPSAEESYDCKVEHWGLDKPLLKHWEPE

Ligand information

>6xp6 Chain C (length=13) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAPQPELPYPQPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xp6 A high-affinity human TCR-like antibody detects celiac disease gluten peptide-MHC complexes and inhibits T cell activation.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	Y9 F51 R52 F54 F58 N62 V65 H68 N69 L73 R76
Binding residue (residue number reindexed from 1)	Y9 F52 R53 F54 F58 N62 V65 H68 N69 L73 R76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xp6, PDBe:6xp6, PDBj:6xp6
PDBsum	6xp6
PubMed	34417258
UniProt	P01909\|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]