Structure of PDB 6xnj Chain A Binding Site BS01

Receptor Information
>6xnj Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
>6xnj Chain B (length=8) Species: 386585 (Escherichia coli O157:H7 str. Sakai) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TQNICTRI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xnj Crystal structure of the PDZ domain of human GOPC in complex with a peptide of E. coli O157:H7 str. Sakai effector NleG8
Resolution1.85 Å
Binding residue
(original residue number in PDB)
G290 L291 I293 S294 I295 T296 H301 S308 H311 Q314 H341 L348
Binding residue
(residue number reindexed from 1)
G15 L16 I18 S19 I20 T21 H26 S33 H36 Q39 H66 L73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:6xnj, PDBe:6xnj, PDBj:6xnj
PDBsum6xnj
PubMed
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]