Structure of PDB 6xmn Chain A Binding Site BS01

Receptor Information
>6xmn Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELC
LDPKENWVQRVVEKFL
Ligand information
>6xmn Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MSNITDPQMWDFDDLNFTGMPPADEDYSP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xmn Solution NMR CXCL8-CXCR1 N-domain complex structure
ResolutionN/A
Binding residue
(original residue number in PDB)		Q8 I10 K11 Y13 S14 K15 P16 F17 H18 P19 F21 G46 R47 L49 C50 W57 R60 K64
Binding residue
(residue number reindexed from 1)		Q8 I10 K11 Y13 S14 K15 P16 F17 H18 P19 F21 G46 R47 L49 C50 W57 R60 K64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008009 chemokine activity
Biological Process
GO:0006935 chemotaxis
GO:0006952 defense response
GO:0006955 immune response
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xmn, PDBe:6xmn, PDBj:6xmn
PDBsum6xmn
PubMed
UniProtP10145|IL8_HUMAN Interleukin-8 (Gene Name=CXCL8)

[Back to BioLiP]