Structure of PDB 6xlx Chain A Binding Site BS01

Receptor Information
>6xlx Chain A (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQD
KNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSV
YVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDS
ATGLSKDYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xlx Representative cancer-associated U2AF2 mutations alter RNA interactions and splicing.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R146 R150 Y152 F197 F199 K225 R227 R228 P229 H230 D231 T252 V254 K260 F262 G264 G265 N289 Y302 F304 K328 K329 A335 G338 A339
Binding residue
(residue number reindexed from 1)		R2 R6 Y8 F53 F55 K81 R83 R84 P85 H86 D87 T108 V110 K116 F118 G120 G121 N145 Y158 F160 K184 K185 A191 G194 A195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xlx, PDBe:6xlx, PDBj:6xlx
PDBsum6xlx
PubMed33020180
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]