Structure of PDB 6xlv Chain A Binding Site BS01

Receptor Information
>6xlv Chain A (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVL
AVQINQDKKFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPG
MENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAF
NLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVG
AKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xlv Representative cancer-associated U2AF2 mutations alter RNA interactions and splicing.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		R146 R150 Y152 N155 F197 F199 K225 R227 R228 P229 H230 D231 T252 V254 K260 F262 G264 G265 N289 Y302 F304 K328 K329 A335 G338 A339 K340
Binding residue
(residue number reindexed from 1)		R9 R13 Y15 N18 F60 F62 K88 R90 R91 P92 H93 D94 T114 V116 K122 F124 G126 G127 N151 Y164 F166 K190 K191 A197 G200 A201 K202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xlv, PDBe:6xlv, PDBj:6xlv
PDBsum6xlv
PubMed33020180
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]