Structure of PDB 6xki Chain A Binding Site BS01

Receptor Information
>6xki Chain A (length=378) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQS
GTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMG
ASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKM
FVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFM
RDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIF
INTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLIT
TDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTE
EDKRTLRDIETFYNTSIEEMPLNVADLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xki Functional mimicry revealed by the crystal structure of an eIF4A:RNA complex bound to the interfacial inhibitor, desmethyl pateamine A.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		P108 T109 R110 G137 V140 T158 G160 R161 D164 R168 R190 F192 Q195 N280 T281 R282 H303 G304 R311 T329 D330 L331
Binding residue
(residue number reindexed from 1)		P80 T81 R82 G109 V112 T130 G132 R133 D136 R140 R162 F164 Q167 N252 T253 R254 H275 G276 R283 T301 D302 L303
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003725 double-stranded RNA binding
GO:0003743 translation initiation factor activity
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0002183 cytoplasmic translational initiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016281 eukaryotic translation initiation factor 4F complex
GO:0048471 perinuclear region of cytoplasm
GO:0097165 nuclear stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xki, PDBe:6xki, PDBj:6xki
PDBsum6xki
PubMed33412110
UniProtP60843|IF4A1_MOUSE Eukaryotic initiation factor 4A-I (Gene Name=Eif4a1)

[Back to BioLiP]