Structure of PDB 6xjd Chain A Binding Site BS01

Receptor Information
>6xjd Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6xjd Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xjd The molecular basis of tight nuclear tethering and inactivation of cGAS.
Resolution6.8 Å
Binding residue
(original residue number in PDB)
R42 R72 R83 F84 Q85
Binding residue
(residue number reindexed from 1)
R6 R36 R47 F48 Q49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6xjd, PDBe:6xjd, PDBj:6xjd
PDBsum6xjd
PubMed32911481
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]