Structure of PDB 6xh2 Chain A Binding Site BS01

Receptor Information
>6xh2 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNSKIKKDELKKSLHAIFSRFGQILDILVPRTRTP
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDKRIP
Ligand information
>6xh2 Chain D (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagaucugagccugggagcucucugc
<<<<<...<<<<......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xh2 Co-crystal structures of HIV TAR RNA bound to lab-evolved proteins show key roles for arginine relevant to the design of cyclic peptide TAR inhibitors.
Resolution1.71 Å
Binding residue
(original residue number in PDB)		A2 Y13 K22 K23 R47 R49 R52 Q54 Q85 A87 K88
Binding residue
(residue number reindexed from 1)		A1 Y12 K21 K22 R46 R48 R51 Q53 Q84 A86 K87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6xh2, PDBe:6xh2, PDBj:6xh2
PDBsum6xh2
PubMed33051202
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]