Structure of PDB 6xh0 Chain A Binding Site BS01

Receptor Information
>6xh0 Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTRPNHTIYINNLNSKIKKDELKKSLHAIFSRFGQILDILVPRRRTPRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDR
Ligand information
>6xh0 Chain D (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagaucugagccugggagcucucugc
<<<<<...<<<<......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xh0 Co-crystal structures of HIV TAR RNA bound to lab-evolved proteins show key roles for arginine relevant to the design of cyclic peptide TAR inhibitors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y13 K23 R47 R48 R49 R52 Q54 Y86 A87 K88
Binding residue
(residue number reindexed from 1)		Y9 K19 R43 R44 R45 R48 Q50 Y82 A83 K84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6xh0, PDBe:6xh0, PDBj:6xh0
PDBsum6xh0
PubMed33051202
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]