Structure of PDB 6xfk Chain A Binding Site BS01

Receptor Information
>6xfk Chain A (length=63) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSI
YQTLLAAHERLQA
Ligand information
>6xfk Chain B (length=11) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LQKWVRVYLDR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xfk Characterization of the Pilotin-Secretin Complex from the Salmonella enterica Type III Secretion System Using Hybrid Structural Methods.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y88 F99 E112 L115 M116 F119 L123 K129 L131 S132 I133
Binding residue
(residue number reindexed from 1)		Y5 F16 E29 L32 M33 F36 L40 K46 L48 S49 I50
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xfk, PDBe:6xfk, PDBj:6xfk
PDBsum6xfk
PubMed32877645
UniProtP0CL43|SCTG_SALTY SPI-1 type 3 secretion system pilotin (Gene Name=invH)

[Back to BioLiP]