Structure of PDB 6xa7 Chain A Binding Site BS01

Receptor Information
>6xa7 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSRHVACLARSEGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRA
GTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLERE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xa7 Structural basis of the human Scribble-Vangl2 association in health and disease.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
G871 L872 F874 S875 I876 T883 S895 R896 H928 V932
Binding residue
(residue number reindexed from 1)
G15 L16 F18 S19 I20 T27 S39 R40 H72 V76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xa7, PDBe:6xa7, PDBj:6xa7
PDBsum6xa7
PubMed33684218
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]