Structure of PDB 6x8l Chain A Binding Site BS01

Receptor Information
>6x8l Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF
DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x8l Caspase-7 in complex with elongated ketomethylene inhibitor
Resolution2.45 Å
Binding residue
(original residue number in PDB)		M84 R87 H144 C186 T189
Binding residue
(residue number reindexed from 1)		M28 R31 H88 C130 T133
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G29 V30 H88 G89 C130
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6x8l, PDBe:6x8l, PDBj:6x8l
PDBsum6x8l
PubMed
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]