Structure of PDB 6x8h Chain A Binding Site BS01

Receptor Information

>6x8h Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTT
TFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGI
IYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVE
TD

Ligand information

>6x8h Chain C (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ADPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6x8h Caspase-8 in complex with AOMK inhibitor, Ac-DW3-KE, forms tetrahedral adduct
Resolution	1.48 Å
Binding residue (original residue number in PDB)	R258 N261
Binding residue (residue number reindexed from 1)	R36 N39

Enzymatic activity

Enzyme Commision number

3.4.22.61: caspase-8.

Gene Ontology

	Molecular Function
GO:0004197	cysteine-type endopeptidase activity
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6x8h, PDBe:6x8h, PDBj:6x8h
PDBsum	6x8h
PubMed
UniProt	Q14790\|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]