Structure of PDB 6x23 Chain A Binding Site BS01

Receptor Information
>6x23 Chain A (length=89) Species: 81824 (Monosiga brevicollis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APEGKMDLIIMRGDKGFGFRLSGATHAQGQWVRNVDPDGQAARAGLQAGD
RLLELNGVDVSFWSHRKVVDEIKRSGDVVAFRIARRLSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x23 Structural characterization and computational analysis of PDZ domains in Monosiga brevicollis.
Resolution2.154 Å
Binding residue
(original residue number in PDB)		G462 F463 G464 F465 R466 L467 S468 G469 T471 H517
Binding residue
(residue number reindexed from 1)		G16 F17 G18 F19 R20 L21 S22 G23 T25 H65
Enzymatic activity
Enzyme Commision number ?
External links