Structure of PDB 6x1j Chain A Binding Site BS01

Receptor Information
>6x1j Chain A (length=226) Species: 1156965 (Wickerhamomyces canadensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IINKKDLLGLGPNSKLIKDYKKQWTTLSKIQEETLIGNILGDVYIKKLKR
NKHFLLQFEWKNKAYIEHIVRVFDEYVISPPTLYERKNHLGNKVITWRAQ
TFEHKAFDKLGYYFMENHKKIIKPDLVLNYITERSLAYWFMDDGGKWDYN
KKTKNKSLVLHTQGFKKEEVEILINDLNIKFNLNCSIKFNKNKPIIYIPN
KDYELFYNLVNPYIIPEMKYKLLFNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1j Structure-Function Studies of Two Yeast Homing Endonucleases that Evolved to Cleave Identical Targets with Dissimilar Rates and Specificities.
Resolution1.945 Å
Binding residue
(original residue number in PDB)		G16 N18 S19 K20 D47 Y49 K51 Q62 E64 K66 N93 L95 W152 D153 K196
Binding residue
(residue number reindexed from 1)		G11 N13 S14 K15 D42 Y44 K46 Q57 E59 K61 N88 L90 W147 D148 K191
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0000373 Group II intron splicing
GO:0006314 intron homing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x1j, PDBe:6x1j, PDBj:6x1j
PDBsum6x1j
PubMed35317996
UniProtQ34807|IEND1_WICCA Probable intron-encoded endonuclease 1

[Back to BioLiP]