Structure of PDB 6wx2 Chain A Binding Site BS01

Receptor Information
>6wx2 Chain A (length=210) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLQSGAELVRPGASVTLSCKASGYAFSDYEIHWVKQTPVRGLDWIGA
FDPKSGASASNQKVKGRAILTADKSSSTAYMELRSLTSEDSAVYYCTRLR
YFGYFDVWGTGTTVTVSSASTTPPSVYPLAPSMVTLGCLVKGYFPEPVTV
TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS
STKVDKKIVP
Ligand information
>6wx2 Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wx2 Mutational fitness landscapes reveal genetic and structural improvement pathways for a vaccine-elicited HIV-1 broadly neutralizing antibody.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		E33 A50 A57 S58 L99 Y101 F102 G103
Binding residue
(residue number reindexed from 1)		E33 A50 A57 S58 L99 Y101 F102 G103
External links