Structure of PDB 6wmf Chain A Binding Site BS01

Receptor Information
>6wmf Chain A (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKT
ALLSIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAV
TLEHVPKALSPNSTISSAPKDFAIFGFDEDLQEGTLLGKFTYDQDGEPIQ
TFHFGTYQVVELRILTNWGHPEYTCIYRFRVHGEPAH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wmf Structural Analysis of Different LINC Complexes Reveals Distinct Binding Modes.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
K570 T571 L573 L574 S575 A603 S641 Y703 C705 Y707
Binding residue
(residue number reindexed from 1)
K49 T50 L52 L53 S54 A79 S117 Y173 C175 Y177
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wmf, PDBe:6wmf, PDBj:6wmf
PDBsum6wmf
PubMed33058875
UniProtQ9UH99|SUN2_HUMAN SUN domain-containing protein 2 (Gene Name=SUN2)

[Back to BioLiP]