Structure of PDB 6wl3 Chain A Binding Site BS01

Receptor Information
>6wl3 Chain A (length=179) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR
WMEQECPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGQDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNATL
Ligand information
>6wl3 Chain B (length=8) Species: 11276 (Vesicular stomatitis virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGYLYQGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wl3 Pre-T cell receptors topologically sample self-ligands during thymocyte beta-selection.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		Y7 V9 R62 E63 K66 N70 F74 D77 V97 Y116 T143 K146 W147 E152 R155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 V9 R62 E63 K66 N70 F74 D77 V97 Y116 T143 K146 W147 E152 R155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wl3, PDBe:6wl3, PDBj:6wl3
PDBsum6wl3
PubMed33335016
UniProtP01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain (Gene Name=H2-K1)

[Back to BioLiP]