Structure of PDB 6wi4 Chain A Binding Site BS01

Receptor Information

>6wi4 Chain A (length=233) Species: 104758 (Porites astreoides)

DTIYKMNKSTRGIAVIINNKDFLRSSGMDRYPRNGTDVDRDALAKLFRAL
KFDVRIYNNQTRAEIRRITKEMAITNHTPYDAFIFSILTHGEEGVIYGTD
GTMAIKDLTAIFKDCTTLVGKPKMFFFQACQGHEYMDGVSVPAEADFVYA
YSTVPGYYSWRNSVNGSWFIQSLTKVFEENAERMDILRMLTRVNAMVSTY
KSRTGDYYSDSKRQVSSVVSMLRKELYFFPENV

Ligand information

>6wi4 Chain D (length=4) Species: 104758 (Porites astreoides)

DEVD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wi4 Caspases from scleractinian coral show unique regulatory features.
• Resolution: 1.57 Å
• Binding residue (original residue number in PDB): R174 H231 Q269 C271 Y311 S312 W313 R314 N315 S316 S355 R356
• Binding residue (residue number reindexed from 1): R33 H90 Q128 C130 Y158 S159 W160 R161 N162 S163 S202 R203

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 19:24:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6wi4', asym_id = 'A', bs = 'BS01', title = 'Caspases from scleractinian coral show unique regulatory features.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6wi4', asym_id='A', bs='BS01', title='Caspases from scleractinian coral show unique regulatory features.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004197,0006508,0008234', uniprot = '', pdbid = '6wi4', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004197,0006508,0008234', uniprot='', pdbid='6wi4', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>