Structure of PDB 6wh8 Chain A Binding Site BS01

Receptor Information

>6wh8 Chain A (length=225) Species: 9606 (Homo sapiens)

RGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKF
LQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLV
QAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAE
FLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAG
LSLLAEERQENLPDEIYHVYSFALR

Ligand information

>6wh8 Chain D (length=4) Species: 32630 (synthetic construct)

tPKR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wh8 Selective Peptidomimetic Inhibitors of NTMT1/2: Rational Design, Synthesis, Characterization, and Crystallographic Studies.
• Resolution: 1.729 Å
• Binding residue (original residue number in PDB): W20 L31 Y34 W136 N168 D177 D180 I214 Y215
• Binding residue (residue number reindexed from 1): W22 L33 Y36 W138 N170 D179 D182 I216 Y217

Enzymatic activity

• Enzyme Commision number: 2.1.1.244: protein N-terminal methyltransferase.

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008276 protein methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0071885 N-terminal protein N-methyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006480 N-terminal protein amino acid methylation
• GO:0007051 spindle organization
• GO:0007059 chromosome segregation
• GO:0018012 N-terminal peptidyl-alanine trimethylation
• GO:0018013 N-terminal peptidyl-glycine methylation
• GO:0018016 N-terminal peptidyl-proline dimethylation
• GO:0032259 methylation
• GO:0035572 N-terminal peptidyl-serine dimethylation
• GO:0035573 N-terminal peptidyl-serine trimethylation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6wh8, PDBe:6wh8, PDBj:6wh8
• PDBsum: 6wh8
• PubMed: 32689795
• UniProt: Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 (Gene Name=NTMT1)