Structure of PDB 6we0 Chain A Binding Site BS01

Receptor Information
>6we0 Chain A (length=119) Species: 10834 (Wheat dwarf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGS
PHLHVLVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDFI
TKEVDSDVNTAEWGTFVAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6we0 Molecular underpinnings of ssDNA specificity by Rep HUH-endonucleases and implications for HUH-tag multiplexing and engineering.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F9 R10 F17 T19 P21 Q22 G56 S57 H59 H61 P75 H91 N93 I94 Q95 K98 Q102 V103 F106 E110
Binding residue
(residue number reindexed from 1)		F2 R3 F10 T12 P14 Q15 G49 S50 H52 H54 P68 H84 N86 I87 Q88 K91 Q95 V96 F99 E103
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.1.21.-
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6we0, PDBe:6we0, PDBj:6we0
PDBsum6we0
PubMed33410911
UniProtQ67622|REP_WDVS Replication-associated protein (Gene Name=C1/C2)

[Back to BioLiP]