Structure of PDB 6wdz Chain A Binding Site BS01

Receptor Information
>6wdz Chain A (length=101) Species: 85708 (Porcine circovirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPHKRWVFTLNNPSEDERKKIRDLPISLFDYFIVGEEGNEEGRTPHLQGF
ANFVKKQTFNKVKWYLGARCHIEKAKGTDQQNKEFCSKEGNLLMECGAPR
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wdz Molecular underpinnings of ssDNA specificity by Rep HUH-endonucleases and implications for HUH-tag multiplexing and engineering.
Resolution2.03 Å
Binding residue
(original residue number in PDB)		V18 T20 N22 N23 T55 H57 Q59 F70 K74 R80 C81 H82 I83 E84 A86 K87 G88 Q92 N93 F96 K99
Binding residue
(residue number reindexed from 1)		V7 T9 N11 N12 T44 H46 Q48 F59 K63 R69 C70 H71 I72 E73 A75 K76 G77 Q81 N82 F85 K88
Enzymatic activity
Enzyme Commision number 2.7.7.-
3.1.21.-
3.6.1.-
Gene Ontology
Biological Process
GO:0006260 DNA replication

View graph for
Biological Process
External links
PDB RCSB:6wdz, PDBe:6wdz, PDBj:6wdz
PDBsum6wdz
PubMed33410911
UniProtQ8BB16|REP_PCV2 Replication-associated protein (Gene Name=Rep)

[Back to BioLiP]