Structure of PDB 6way Chain A Binding Site BS01

Receptor Information
>6way Chain A (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVSSFLVRPSDNTPGDYSL
YFRTNENIQRFKISPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLK
EPVPMQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6way The GTPase-activating protein p120RasGAP has an evolutionarily conserved "FLVR-unique" SH2 domain.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
S379 N381 S387 R398 F399 K400 M411 G412 Y426 I431 E433
Binding residue
(residue number reindexed from 1)
S41 N43 S49 R60 F61 K62 M73 G74 Y88 I93 E95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6way, PDBe:6way, PDBj:6way
PDBsum6way
PubMed32540970
UniProtP20936|RASA1_HUMAN Ras GTPase-activating protein 1 (Gene Name=RASA1)

[Back to BioLiP]