Structure of PDB 6wav Chain A Binding Site BS01

Receptor Information
>6wav Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWK
DISPAALPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wav Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
W41 D43 L46 Y47 F65 E66 D67 D68 F71
Binding residue
(residue number reindexed from 1)
W15 D17 L20 Y21 F39 E40 D41 D42 F45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wav, PDBe:6wav, PDBj:6wav
PDBsum6wav
PubMed32869745
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]