Structure of PDB 6w7a Chain A Binding Site BS01

Receptor Information
>6w7a Chain A (length=178) Species: 11320 (Influenza A virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFM
YSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENR
FIDIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE
SRARIKTRLFTIRQEMASRSLWDSFRQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w7a Structural insights into the substrate specificity of the endonuclease activity of the influenza virus cap-snatching mechanism.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		A20 M21 Y24 K34 I38 H41 F105 V122 T123 R124 R125 Y130 S194
Binding residue
(residue number reindexed from 1)		A23 M24 Y27 K37 I41 H44 F89 V106 T107 R108 R109 Y114 S178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0039694 viral RNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6w7a, PDBe:6w7a, PDBj:6w7a
PDBsum6w7a
PubMed33469660
UniProtC6H0Y9

[Back to BioLiP]