Structure of PDB 6w51 Chain A Binding Site BS01

Receptor Information
>6w51 Chain A (length=268) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYG
CDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAA
HVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTTELVETRPAGDGTFQKWAAVVVPSG
QEQRYTCHVQHEGLPKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w51 Targeting a neoantigen derived from a common TP53 mutation.
Resolution3.53 Å
Binding residue
(original residue number in PDB)
Y7 F9 M45 E63 R65 K66 V67 D77 T80 Y99 Y116 T143 W147 A150 Y159 T163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 F9 M45 E63 R65 K66 V67 D77 T80 Y99 Y116 T143 W147 A150 Y159 T163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links