Structure of PDB 6vtx Chain A Binding Site BS01

Receptor Information
>6vtx Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vtx Liquid condensation of reprogramming factor KLF4 with DNA provides a mechanism for chromatin organization.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		H446 W469 R473 E476 R479 H480 F499 R501 H504 H508
Binding residue
(residue number reindexed from 1)		H17 W40 R44 E47 R50 H51 F70 R72 H75 H79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6vtx, PDBe:6vtx, PDBj:6vtx
PDBsum6vtx
PubMed34552088
UniProtO43474|KLF4_HUMAN Krueppel-like factor 4 (Gene Name=KLF4)

[Back to BioLiP]