Structure of PDB 6vqy Chain A Binding Site BS01

Receptor Information
>6vqy Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWE
Ligand information
>6vqy Chain F (length=7) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRWIILG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vqy Epitope length variants balance protective immune responses and viral escape in HIV-1 infection
Resolution2.57 Å
Binding residue
(original residue number in PDB)
Y7 H9 T24 E45 E63 I66 C67 Y99 V152 Q155 L156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 H9 T24 E45 E63 I66 C67 Y99 V152 Q155 L156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links