Structure of PDB 6vpz Chain A Binding Site BS01

Receptor Information
>6vpz Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>6vpz Chain C (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRWIILGLNKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vpz Epitope length variants balance protective immune responses and viral escape in HIV-1 infection
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y7 T24 E45 R62 E63 C67 E76 D77 Y84 Y99 H114 T143 K146 W147 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 T24 E45 R62 E63 C67 E76 D77 Y84 Y99 H114 T143 K146 W147 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links