Structure of PDB 6vj9 Chain A Binding Site BS01

Receptor Information
>6vj9 Chain A (length=179) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHA
LMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKF
SGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWF
DLFGMSMANGAHIAGLAVGLAMAFVDSLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vj9 Designed Parasite-Selective Rhomboid Inhibitors Block Invasion and Clear Blood-Stage Malaria.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F146 H150 N154 W196 F197 G198 G199 S201 M247 S248 M249 A250 H254
Binding residue
(residue number reindexed from 1)		F54 H58 N62 W104 F105 G106 G107 S109 M155 S156 M157 A158 H162
Enzymatic activity
Enzyme Commision number 3.4.21.105: rhomboid protease.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vj9, PDBe:6vj9, PDBj:6vj9
PDBsum6vj9
PubMed32888502
UniProtP09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]