Structure of PDB 6ven Chain A Binding Site BS01

Receptor Information
>6ven Chain A (length=106) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARTKQTARPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVKALQEASEAYLVALFEDTNLCAIHAKRVTIKPKDIQLARR
IRGERA
Ligand information
>6ven Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ven Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
Resolution3.37 Å
Binding residue
(original residue number in PDB)
H39 R40 Y41 G44 V46 R49 K64 L65 R69
Binding residue
(residue number reindexed from 1)
H10 R11 Y12 G15 V17 R20 K35 L36 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6ven, PDBe:6ven, PDBj:6ven
PDBsum6ven
PubMed31922488
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]