Structure of PDB 6vdb Chain A Binding Site BS01

Receptor Information
>6vdb Chain A (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERMQCECTPLSKDER
AQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEK
KGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMAL
KNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSG
SELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vdb Sequence specificity analysis of the SETD2 protein lysine methyltransferase and discovery of a SETD2 super-substrate.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		M1526 Y1579 F1589 Y1604 F1606 M1607 A1608 E1636 T1637 Y1666 Q1667 F1668 Q1669 Y1671 G1672 K1673 E1674 A1700 G1702
Binding residue
(residue number reindexed from 1)		M67 Y120 F130 Y145 F147 M148 A149 E177 T178 Y207 Q208 F209 Q210 Y212 G213 K214 E215 A241 G243
Enzymatic activity
Catalytic site (original residue number in PDB) Y1579 Y1666
Catalytic site (residue number reindexed from 1) Y120 Y207
Enzyme Commision number 2.1.1.-
2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6vdb, PDBe:6vdb, PDBj:6vdb
PDBsum6vdb
PubMed32939018
UniProtQ9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)

[Back to BioLiP]