Structure of PDB 6vbx Chain A Binding Site BS01

Receptor Information
>6vbx Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELYRQSLEIISRYLREQATGAGATSRKALETLRRVGDGVQRNHETAFQGM
LRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTI
NQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vbx Design, Synthesis, and Structural Characterization of Lysine Covalent BH3 Peptides Targeting Mcl-1.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		H224 M231 K234 H252 V253 D256 G262 R263 T266
Binding residue
(residue number reindexed from 1)		H43 M50 K53 H71 V72 D75 G81 R82 T85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6vbx, PDBe:6vbx, PDBj:6vbx
PDBsum6vbx
PubMed33797903
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]