Structure of PDB 6vb0 Chain A Binding Site BS01

Receptor Information
>6vb0 Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDVGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
REAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vb0 HLA-B*15:02 complexed with a synthetic peptide
Resolution1.9 Å
Binding residue
(original residue number in PDB)
Y7 Y9 R62 N63 I66 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 E152 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 R62 N63 I66 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 E152 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links