Structure of PDB 6v4e Chain A Binding Site BS01

Receptor Information
>6v4e Chain A (length=90) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQ
RQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v4e Identification of a Structural Determinant for Selective Targeting of HDMX.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		K47 M50 H51 G54 I57 Y63 Q68 H69 V89
Binding residue
(residue number reindexed from 1)		K31 M34 H35 G38 I41 Y47 Q52 H53 V73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v4e, PDBe:6v4e, PDBj:6v4e
PDBsum6v4e
PubMed32359398
UniProtQ7ZUW7|MDM4_DANRE Protein Mdm4 (Gene Name=mdm4)

[Back to BioLiP]