Structure of PDB 6v3j Chain A Binding Site BS01

Receptor Information
>6v3j Chain A (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v3j The molecular basis of how buried human leukocyte antigen polymorphism modulates natural killer cell function.
Resolution1.98 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 M67 S70 T73 N77 I80 Y84 Y99 Y123 T143 K146 W147 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 M67 S70 T73 N77 I80 Y84 Y99 Y123 T143 K146 W147 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links