Structure of PDB 6v2s Chain A Binding Site BS01

Receptor Information
>6v2s Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLE
FRKKIAENKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v2s Structural Basis for the Binding Selectivity of Human CDY Chromodomains.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
V58 F59 E60 V61 W80 Y83 E91 H95 C99
Binding residue
(residue number reindexed from 1)
V3 F4 E5 V6 W25 Y28 E36 H40 C44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6v2s, PDBe:6v2s, PDBj:6v2s
PDBsum6v2s
PubMed32470319
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]