Structure of PDB 6v2q Chain A Binding Site BS01

Receptor Information
>6v2q Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v2q The molecular basis of how buried human leukocyte antigen polymorphism modulates natural killer cell function.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 S70 E76 N77 I80 Y84 Y99 Y123 T143 K146 W147 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 S70 E76 N77 I80 Y84 Y99 Y123 T143 K146 W147 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links