Structure of PDB 6uyz Chain A Binding Site BS01

Receptor Information
>6uyz Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQ
RIADNHTPKELGMEEEDVIEVYQEQTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uyz Acetylation of SUMO1 Alters Interactions with the SIMs of PML and Daxx in a Protein-Specific Manner.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		K23 E33 I34 H35 F36 K37 K46 L47 R54
Binding residue
(residue number reindexed from 1)		K4 E14 I15 H16 F17 K18 K27 L28 R35
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6uyz, PDBe:6uyz, PDBj:6uyz
PDBsum6uyz
PubMed31879127
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]