Structure of PDB 6uyy Chain A Binding Site BS01

Receptor Information
>6uyy Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEG
QRIADNHTPKELGMEEEDVIEVYQEQTGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uyy Acetylation of SUMO1 Alters Interactions with the SIMs of PML and Daxx in a Protein-Specific Manner.
Resolution1.599 Å
Binding residue
(original residue number in PDB)		Y21 E33 I34 H35 F36 K37 T42 K46 L47 R54
Binding residue
(residue number reindexed from 1)		Y3 E15 I16 H17 F18 K19 T24 K28 L29 R36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6uyy, PDBe:6uyy, PDBj:6uyy
PDBsum6uyy
PubMed31879127
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]