Structure of PDB 6uyx Chain A Binding Site BS01

Receptor Information
>6uyx Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEG
QRIADNHTPKELGMEEEDVIEVYQEQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uyx Acetylation of SUMO1 Alters Interactions with the SIMs of PML and Daxx in a Protein-Specific Manner.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
R63 G68 R70 E89 Y91
Binding residue
(residue number reindexed from 1)
R45 G50 R52 E71 Y73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6uyx, PDBe:6uyx, PDBj:6uyx
PDBsum6uyx
PubMed31879127
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]