Structure of PDB 6uyi Chain A Binding Site BS01

Receptor Information
>6uyi Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNV
EDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEE
HCRKVNEYLNNPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uyi An Extended Conformation for K48 Ubiquitin Chains Revealed by the hRpn2:Rpn13:K48-Diubiquitin Structure.
ResolutionN/A
Binding residue
(original residue number in PDB)		T36 T37 V38 P40 K44 Q87 C88 R92 R104 F106 W108 Q110 E111
Binding residue
(residue number reindexed from 1)		T17 T18 V19 P21 K25 Q68 C69 R73 R85 F87 W89 Q91 E92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:6uyi, PDBe:6uyi, PDBj:6uyi
PDBsum6uyi
PubMed32160516
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]