Structure of PDB 6uwk Chain A Binding Site BS01

Receptor Information

>6uwk Chain A (length=294) Species: 32630 (synthetic construct)

ASSINPWILTGFADAEGSFLLRIRKYSQTRVGYLTELGFQITLHNKDKSI
LENIQSTWGVGVIANSGDNAVSLKVTRFEDLKVIIDHFEKYPLITQKYAD
YMLFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIISK
ERSLINKNIPNFKWLAGFTSGDGCFFVNLSKKKTKLGVQVKLVFSISQHI
RDKNLMNSLITYLGCGYIKKKNKSEFSWLEFVVTKFSDIRDKIIPFFQEY
TLIGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKG

Ligand information

>6uwk Chain B (length=25)

ggcctccacttattcgacctctcag

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6uwk Optimization of Protein Thermostability and Exploitation of Recognition Behavior to Engineer Altered Protein-DNA Recognition.
• Resolution: 2.533 Å
• Binding residue (original residue number in PDB): Y32 Q34 T35 L40 E42 V68 S72 G73 R83 F84 H122 L123 W140 G177 D178 G179 C180 F182 N184 S186 S203 Q204 H205 K229 F232 W234 K294 N298
• Binding residue (residue number reindexed from 1): Y26 Q28 T29 L34 E36 V62 S66 G67 R77 F78 H116 L117 W134 G171 D172 G173 C174 F176 N178 S180 S197 Q198 H199 K223 F226 W228 K288 N292

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 14:35:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6uwk', asym_id = 'A', bs = 'BS01', title = 'Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6uwk', asym_id='A', bs='BS01', title='Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '6uwk', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='6uwk', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>