Structure of PDB 6uls Chain A Binding Site BS01

Receptor Information
>6uls Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKL
NLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKP
GDDIVLMAEALEKLFLQKINELPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uls BET-Family Bromodomains Can Recognize Diacetylated Sequences from Transcription Factors Using a Conserved Mechanism.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
Q78 W81 V87 L92 Y139 N140 D145 I146 M149
Binding residue
(residue number reindexed from 1)
Q36 W39 V45 L50 Y97 N98 D103 I104 M107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6uls, PDBe:6uls, PDBj:6uls
PDBsum6uls
PubMed33620209
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]